Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-43 IGKV1D-43

UniProt

A0A0B4J1Z2

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPFSLSASVGDRVTITCWASQGISSYLAWYQQKPAKAPKLFIYYASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYYSTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal MCAM/CD146 Antibody (733216) [HRP]
FAB7718H 0.1 mL

Rat Monoclonal MCAM/CD146 Antibody (733216) [HRP]

Sign In for Pricing
View Details
UBC9 (SUMO-conjugating Enzyme UBC9, SUMO-protein Ligase, Ubiquitin-conjugating Enzyme E2 I, Ubiquitin-protein Ligase I, Ubiquitin Carrier Protein I, Ubiquitin Carrier Protein 9, p18, UBE2I, UBC9, UBCE9) (MaxLight 405) discontinued
U0880-03B-ML405 100 µL

UBC9 (SUMO-conjugating Enzyme UBC9, SUMO-protein Ligase, Ubiquitin-conjugating Enzyme E2 I, Ubiquitin-protein Ligase I, Ubiquitin Carrier Protein I, Ubiquitin Carrier Protein 9, p18, UBE2I, UBC9, UBCE9) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial
orb1653211-01 20 µg

Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial

Sign In for Pricing
View Details
Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial
orb1653211-02 100 µg

Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial

Sign In for Pricing
View Details
Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial
orb1653211-03 1 mg

Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial

Sign In for Pricing
View Details
Rno-miR-770-3p miRNA Antagomir
orb1911278-01 10 nmol

Rno-miR-770-3p miRNA Antagomir

Sign In for Pricing
View Details