Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 2 (TVA2), Biotinylated

This Recombinant Human T cell receptor alpha variable 2 (TVA2), Biotinylated spans the amino acid sequence from region 26-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 2 TRAV2

UniProt

A0A0B4J234

Expression Region

26-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7H3 (CD276) (NM_001024736) Human Over-expression Lysate
LY422539 100 µg

B7H3 (CD276) (NM_001024736) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Regulator Of G Protein Signaling 6 (RGS6) ELISA Kit
RD-RGS6-Ra-01 96 Tests

Rat Regulator Of G Protein Signaling 6 (RGS6) ELISA Kit

Sign In for Pricing
View Details
Rat Regulator Of G Protein Signaling 6 (RGS6) ELISA Kit
RD-RGS6-Ra-02 48 Tests

Rat Regulator Of G Protein Signaling 6 (RGS6) ELISA Kit

Sign In for Pricing
View Details
CD45RA (PTPRC/818), Biotin conjugate, 0.1mg/mL
BNCB0818-500 1x 500 µL

CD45RA (PTPRC/818), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Cytokeratin-17 Antibody
RC-16708-01 50 μL

Recombinant Cytokeratin-17 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-17 Antibody
RC-16708-02 100 µL

Recombinant Cytokeratin-17 Antibody

Sign In for Pricing
View Details