Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 2 (TVA2), Biotinylated

This Recombinant Human T cell receptor alpha variable 2 (TVA2), Biotinylated spans the amino acid sequence from region 26-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 2 TRAV2

UniProt

A0A0B4J234

Expression Region

26-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dux4 (DUX4L1) Human Gene Knockout Kit (CRISPR)
KN416160 1 Kit

Dux4 (DUX4L1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cript (NM_019936) Mouse Tagged ORF Clone
MG200309 10 µg

Cript (NM_019936) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
3',5'-Di-O-acetyl-2'-deoxy-2'-fluorouridine
TRC-D422508-50MG 50 mg

3',5'-Di-O-acetyl-2'-deoxy-2'-fluorouridine

Sign In for Pricing
View Details
Human TSPEAR activation kit by CRISPRa
GA110057 1 Kit

Human TSPEAR activation kit by CRISPRa

Sign In for Pricing
View Details
Calhex 231
TRC-C148000-50MG 50 mg

Calhex 231

Sign In for Pricing
View Details
PE Anti-Human CD180 Antibody[MHR73-11]
AN00326D-01 20 Tests

PE Anti-Human CD180 Antibody[MHR73-11]

Sign In for Pricing
View Details