Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 2 (TVA2), Biotinylated

This Recombinant Human T cell receptor alpha variable 2 (TVA2), Biotinylated spans the amino acid sequence from region 26-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 2 TRAV2

UniProt

A0A0B4J234

Expression Region

26-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MAGEA12 activation kit by CRISPRa
GA102795 1 Kit

Human MAGEA12 activation kit by CRISPRa

Sign In for Pricing
View Details
CD40L Recombinant Rabbit monoclonal Antibody
HA750387 100 µL

CD40L Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
2-Bromo-5-picoline-d3
TRC-B685572-1MG 1 mg

2-Bromo-5-picoline-d3

Sign In for Pricing
View Details
FBXO34 Antibody
KC-2699-01 50 μL

FBXO34 Antibody

Sign In for Pricing
View Details
FBXO34 Antibody
KC-2699-02 100 µL

FBXO34 Antibody

Sign In for Pricing
View Details
FBXO34 Antibody
KC-2699-03 1 mL

FBXO34 Antibody

Sign In for Pricing
View Details