Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 2 (TVA2), Biotinylated

This Recombinant Human T cell receptor alpha variable 2 (TVA2), Biotinylated spans the amino acid sequence from region 26-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 2 TRAV2

UniProt

A0A0B4J234

Expression Region

26-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1378 Protein Vector (Mouse) (pPM-C-HA)
PV209160 500 ng

Olfr1378 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Isoeleutherin
BA1772-5 5 mg

Isoeleutherin

Sign In for Pricing
View Details
Cct7 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4977703 1.0 µg DNA

Cct7 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
NOP56 Ribonucleoprotein (NOP56) Antibody
abx235795 100 µg

NOP56 Ribonucleoprotein (NOP56) Antibody

Sign In for Pricing
View Details
Rabbit Anti C1GALT1C1 Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA) 120ul
IRBAMLC1GALT1C1AAP560120UL 120 µL

Rabbit Anti C1GALT1C1 Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA) 120ul

Sign In for Pricing
View Details
CB2 Human Recombinant Protein, Membrane Nanoparticle
TP721872M 100 µg

CB2 Human Recombinant Protein, Membrane Nanoparticle

Sign In for Pricing
View Details