Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-2 (TVAM2), Biotinylated

This Recombinant Human T cell receptor alpha variable 13-2 (TVAM2), Biotinylated spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-2 TRAV13-2

UniProt

A0A0B4J235

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-WDR4
YF-PA17214 100 ug

anti-WDR4

Sign In for Pricing
View Details
FAIM3 Protein Vector (Human) (pPM-C-HA)
PV014935 500 ng

FAIM3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Kras G12R, GST-tag, GDP Loaded
5727-4127G-G-01 50 µg

Kras G12R, GST-tag, GDP Loaded

Sign In for Pricing
View Details
Kras G12R, GST-tag, GDP Loaded
5727-4127G-G-02 100 µg

Kras G12R, GST-tag, GDP Loaded

Sign In for Pricing
View Details
TNK1 Human Gene Knockout Kit (CRISPR)
KN423073 1 Kit

TNK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse monoclonal L1CAM antibody
MBS5306582-01 0.1 mL

Mouse monoclonal L1CAM antibody

Sign In for Pricing
View Details