Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-2 (TVAM2), Biotinylated

This Recombinant Human T cell receptor alpha variable 13-2 (TVAM2), Biotinylated spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-2 TRAV13-2

UniProt

A0A0B4J235

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIN1 inhibitor API-1
S6893-25mg 25 mg

PIN1 inhibitor API-1

Sign In for Pricing
View Details
KIAA1199 (CEMIP) (C-term) Rabbit Polyclonal Antibody
AP52281PU-N 400 µL

KIAA1199 (CEMIP) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TFIIF (GTF2F1) (NM_002096) Human Over-expression Lysate
LC400767 20 µg

TFIIF (GTF2F1) (NM_002096) Human Over-expression Lysate

Sign In for Pricing
View Details
ANKFY1 Adenovirus (Human)
11916051 1.0 mL

ANKFY1 Adenovirus (Human)

Sign In for Pricing
View Details
TPC1 Antibody
orb852124 2 mg

TPC1 Antibody

Sign In for Pricing
View Details
CLCN7
521603-01 100 µL

CLCN7

Sign In for Pricing
View Details