Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-2 (TVAM2), Biotinylated

This Recombinant Human T cell receptor alpha variable 13-2 (TVAM2), Biotinylated spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-2 TRAV13-2

UniProt

A0A0B4J235

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ERR beta/NR3B2 Antibody [Janelia Fluor 646]
NBP2-99541JF646 0.1 mL

Rabbit Polyclonal ERR beta/NR3B2 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
CCT5 Rabbit pAb
E45R26626N 50 ul

CCT5 Rabbit pAb

Sign In for Pricing
View Details
MAP2 Protein Lysate (Human) with C-Ha Tag
28011031 100 µg

MAP2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Herpes Simplex Virus Glycoprotein D
045919 100 µL

Herpes Simplex Virus Glycoprotein D

Sign In for Pricing
View Details
TMC8 Peptide
AF9215-BP 1 mg

TMC8 Peptide

Sign In for Pricing
View Details
2310028O11Rik sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4482002 1.0 µg DNA

2310028O11Rik sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details