Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-2 (TVA12), Biotinylated

This Recombinant Human T cell receptor alpha variable 1-2 (TVA12), Biotinylated spans the amino acid sequence from region 19-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-2 TRAV1-2

UniProt

A0A0B4J238

Expression Region

19-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BNP Antibody (NPPB/4493) [CoraFluor 1]
NBP3-14020CL1 0.1 mL

Mouse Monoclonal BNP Antibody (NPPB/4493) [CoraFluor 1]

Sign In for Pricing
View Details
CD49c (Integrin alpha 3, FRP2, Galactoprotein B3, GAPB3, ITGA3, URO1, VCA-2, Very Late Activation Protein 3 Receptor Alpha 3 Subunit, VLA-3 alpha Chain, VL3A, VLA-3) (MaxLight 405)
MBS6252592-01 0.1 mL

CD49c (Integrin alpha 3, FRP2, Galactoprotein B3, GAPB3, ITGA3, URO1, VCA-2, Very Late Activation Protein 3 Receptor Alpha 3 Subunit, VLA-3 alpha Chain, VL3A, VLA-3) (MaxLight 405)

Sign In for Pricing
View Details
CD49c (Integrin alpha 3, FRP2, Galactoprotein B3, GAPB3, ITGA3, URO1, VCA-2, Very Late Activation Protein 3 Receptor Alpha 3 Subunit, VLA-3 alpha Chain, VL3A, VLA-3) (MaxLight 405)
MBS6252592-02 5x 0.1 mL

CD49c (Integrin alpha 3, FRP2, Galactoprotein B3, GAPB3, ITGA3, URO1, VCA-2, Very Late Activation Protein 3 Receptor Alpha 3 Subunit, VLA-3 alpha Chain, VL3A, VLA-3) (MaxLight 405)

Sign In for Pricing
View Details
ROBO4 (NM_019055) Human Tagged Lenti ORF Clone
RC213730L2 10 µg

ROBO4 (NM_019055) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Bifidobacterium adolescentis ATP synthase subunit delta (atpH)
MBS1237712-01 0.02 mg (E-Coli)

Recombinant Bifidobacterium adolescentis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Bifidobacterium adolescentis ATP synthase subunit delta (atpH)
MBS1237712-02 0.02 mg (Yeast)

Recombinant Bifidobacterium adolescentis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details