Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-1 (TVAM1), Biotinylated

This Recombinant Human T cell receptor alpha variable 13-1 (TVAM1), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-1 TRAV13-1

UniProt

A0A0B4J241

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-500 1x 500 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL
BNC940008-100 1x 100 µL

MAGE A1 (MA454), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), CF594 conjugate, 0.1mg/mL
BNC942618-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF405S conjugate, 0.1mg/mL
BNC040252-500 1x 500 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details