Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-1 (TVAM1), Biotinylated

This Recombinant Human T cell receptor alpha variable 13-1 (TVAM1), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-1 TRAV13-1

UniProt

A0A0B4J241

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS529650 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
SARS (Seryl-tRNA Synthetase, Cytoplasmic, Seryl-tRNA(Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SERS, FLJ36399) (MaxLight 550)
MBS6393284-01 0.1 mL

SARS (Seryl-tRNA Synthetase, Cytoplasmic, Seryl-tRNA(Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SERS, FLJ36399) (MaxLight 550)

Sign In for Pricing
View Details
SARS (Seryl-tRNA Synthetase, Cytoplasmic, Seryl-tRNA(Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SERS, FLJ36399) (MaxLight 550)
MBS6393284-02 5x 0.1 mL

SARS (Seryl-tRNA Synthetase, Cytoplasmic, Seryl-tRNA(Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SERS, FLJ36399) (MaxLight 550)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Cluster Of Differentiation 19 (CD19)
MBS2142908-01 0.1 mL

FITC-Linked Monoclonal Antibody to Cluster Of Differentiation 19 (CD19)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Cluster Of Differentiation 19 (CD19)
MBS2142908-02 0.2 mL

FITC-Linked Monoclonal Antibody to Cluster Of Differentiation 19 (CD19)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Cluster Of Differentiation 19 (CD19)
MBS2142908-03 0.5 mL

FITC-Linked Monoclonal Antibody to Cluster Of Differentiation 19 (CD19)

Sign In for Pricing
View Details