Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 3 (TVA3), Biotinylated

This Recombinant Human T cell receptor alpha variable 3 (TVA3), Biotinylated spans the amino acid sequence from region 21-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 3 TRAV3

UniProt

A0A0B4J244

Expression Region

21-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVAQPEDQVNVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Midkine, NT (MK, Amphiregulin Associated Protein, ARAP, FLJ27379, Midgestation and Kidney Protein, MDK, MK1, Neurite Growth Promoting Factor 2, NEGF2, Neurite Outgrowth Promoting Protein) (FITC)
MBS6488172-01 0.2 mL

Midkine, NT (MK, Amphiregulin Associated Protein, ARAP, FLJ27379, Midgestation and Kidney Protein, MDK, MK1, Neurite Growth Promoting Factor 2, NEGF2, Neurite Outgrowth Promoting Protein) (FITC)

Sign In for Pricing
View Details
Midkine, NT (MK, Amphiregulin Associated Protein, ARAP, FLJ27379, Midgestation and Kidney Protein, MDK, MK1, Neurite Growth Promoting Factor 2, NEGF2, Neurite Outgrowth Promoting Protein) (FITC)
MBS6488172-02 5x 0.2 mL

Midkine, NT (MK, Amphiregulin Associated Protein, ARAP, FLJ27379, Midgestation and Kidney Protein, MDK, MK1, Neurite Growth Promoting Factor 2, NEGF2, Neurite Outgrowth Promoting Protein) (FITC)

Sign In for Pricing
View Details
Mouse Nppb activation kit by CRISPRa
GA202950 1 Kit

Mouse Nppb activation kit by CRISPRa

Sign In for Pricing
View Details
Monocyte Chemotactic Protein-2 Canine Recombinant (CCL8)
rAP-0196 1 Each

Monocyte Chemotactic Protein-2 Canine Recombinant (CCL8)

Sign In for Pricing
View Details
GRHPR Antibody - N-terminal region
ARP48317_P050-25UL 25 µL

GRHPR Antibody - N-terminal region

Sign In for Pricing
View Details
2-Bromo-4-formylnicotinonitrile
OR89202-01 100 mg

2-Bromo-4-formylnicotinonitrile

Sign In for Pricing
View Details