Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 3 (TVA3), Biotinylated

This Recombinant Human T cell receptor alpha variable 3 (TVA3), Biotinylated spans the amino acid sequence from region 21-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 3 TRAV3

UniProt

A0A0B4J244

Expression Region

21-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVAQPEDQVNVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Midkine (MDK) Rabbit Polyclonal Antibody
TA354460 100 µg

Midkine (MDK) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cox6a2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6862904 1.0 µg DNA

Cox6a2 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
MAGI3-Akt3 Fusion Protein (Membrane- Associated Guanylate Kinase inverted 3) discontinued
351853 100 µL

MAGI3-Akt3 Fusion Protein (Membrane- Associated Guanylate Kinase inverted 3) discontinued

Sign In for Pricing
View Details
Neurokin B receptor Rabbit Polyclonal Antibody (PerCP)
orb1573678 100 µL

Neurokin B receptor Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
LEPREL1 (P3H2) (NM_018192) Human Untagged Clone
SC125458 10 µg

LEPREL1 (P3H2) (NM_018192) Human Untagged Clone

Sign In for Pricing
View Details
Human Pcdhβ2 (Protocadherin Beta 2) ELISA Kit
FY-EH3772 96 Well

Human Pcdhβ2 (Protocadherin Beta 2) ELISA Kit

Sign In for Pricing
View Details