Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 3 (TVA3), Biotinylated

This Recombinant Human T cell receptor alpha variable 3 (TVA3), Biotinylated spans the amino acid sequence from region 21-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 3 TRAV3

UniProt

A0A0B4J244

Expression Region

21-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVAQPEDQVNVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD17B11 siRNA (Rat)
orb1829866-01 15 nmol

HSD17B11 siRNA (Rat)

Sign In for Pricing
View Details
HSD17B11 siRNA (Rat)
orb1829866-02 30 nmol

HSD17B11 siRNA (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal p53 Antibody (rTP53/8579) [DyLight 350]
NBP3-21043UV 0.1 mL

Mouse Monoclonal p53 Antibody (rTP53/8579) [DyLight 350]

Sign In for Pricing
View Details
RPL21P46-set siRNA/shRNA/RNAi Lentivector (Human)
41049091 4x 500 ng

RPL21P46-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
KCNG3 (N-Term) Rabbit pAb
MBS8554380-01 0.1 mL

KCNG3 (N-Term) Rabbit pAb

Sign In for Pricing
View Details
KCNG3 (N-Term) Rabbit pAb
MBS8554380-02 0.1 mL (AF405L)

KCNG3 (N-Term) Rabbit pAb

Sign In for Pricing
View Details