Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-1 (TVAL1), Biotinylated

This Recombinant Human T cell receptor alpha variable 12-1 (TVAL1), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-1 TRAV12-1

UniProt

A0A0B4J245

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coiled-coil domain-containing protein 130 (CCDC130) Mouse ELISA Kit
C4649 96 Tests

Coiled-coil domain-containing protein 130 (CCDC130) Mouse ELISA Kit

Sign In for Pricing
View Details
PAFAH1B1 Rabbit Polyclonal Antibody
E10G11000 100 µL

PAFAH1B1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hsa-miR-8068 miRNA Inhibitor
CIH2542-01 10 nmol

Hsa-miR-8068 miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-8068 miRNA Inhibitor
CIH2542-02 20 nmol

Hsa-miR-8068 miRNA Inhibitor

Sign In for Pricing
View Details
Recombinant Dechloromonas aromatica Phosphate acyltransferase (plsX)
MBS1442229-01 0.02 mg (E-Coli)

Recombinant Dechloromonas aromatica Phosphate acyltransferase (plsX)

Sign In for Pricing
View Details
Recombinant Dechloromonas aromatica Phosphate acyltransferase (plsX)
MBS1442229-02 0.02 mg (Yeast)

Recombinant Dechloromonas aromatica Phosphate acyltransferase (plsX)

Sign In for Pricing
View Details