Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-1 (TVAL1), Biotinylated

This Recombinant Human T cell receptor alpha variable 12-1 (TVAL1), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-1 TRAV12-1

UniProt

A0A0B4J245

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST3GAL5 Polyclonal Antibody
orb618274-01 50 μL

ST3GAL5 Polyclonal Antibody

Sign In for Pricing
View Details
ST3GAL5 Polyclonal Antibody
orb618274-02 100 µL

ST3GAL5 Polyclonal Antibody

Sign In for Pricing
View Details
ORC4L (ORC4) (NM_002552) Human Recombinant Protein
E45H41344M5 20 µg

ORC4L (ORC4) (NM_002552) Human Recombinant Protein

Sign In for Pricing
View Details
FBXW10 Human shRNA Plasmid Kit (Locus ID 10517)
TL304545 1 Kit

FBXW10 Human shRNA Plasmid Kit (Locus ID 10517)

Sign In for Pricing
View Details
KRTAP4-3 Double Nickase Plasmid (h)
sc-413765-NIC 20 µg

KRTAP4-3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Mouse Thrombopoietin (TPO) ELISA Kit
EKU07637 96 Tests

Mouse Thrombopoietin (TPO) ELISA Kit

Sign In for Pricing
View Details