Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-1 (TVAL1), Biotinylated

This Recombinant Human T cell receptor alpha variable 12-1 (TVAL1), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-1 TRAV12-1

UniProt

A0A0B4J245

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[1- (4-Fluorophenyl) -3-methylbutan-2-yl] (methyl) amine
JXB76122-01 50 mg

[1- (4-Fluorophenyl) -3-methylbutan-2-yl] (methyl) amine

Sign In for Pricing
View Details
[1- (4-Fluorophenyl) -3-methylbutan-2-yl] (methyl) amine
JXB76122-02 0.5 g

[1- (4-Fluorophenyl) -3-methylbutan-2-yl] (methyl) amine

Sign In for Pricing
View Details
syntenin-2 Lentiviral Activation Particles (m)
sc-432800-LAC 200 µL

syntenin-2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Recombinant HAdV-2 E1B-19K Protein, N-GST & C-His
YVV02404 100 μg

Recombinant HAdV-2 E1B-19K Protein, N-GST & C-His

Sign In for Pricing
View Details
SAE1, CT (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A)
MBS631211-01 0.2 mL

SAE1, CT (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A)

Sign In for Pricing
View Details
SAE1, CT (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A)
MBS631211-02 5x 0.2 mL

SAE1, CT (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A)

Sign In for Pricing
View Details