Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-1 (TVA11), Biotinylated

This Recombinant Human T cell receptor alpha variable 1-1 (TVA11), Biotinylated spans the amino acid sequence from region 19-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-1 TRAV1-1

UniProt

A0A0B4J248

Expression Region

19-108

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGRFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Desmin (Thr76 + Thr77) Polyclonal Antibody, PerCP Conjugated
bs-5302R-PerCP 100 µL

Phospho-Desmin (Thr76 + Thr77) Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
FRA2 Rabbit Polyclonal Antibody (BF750)
orb1602638 100 µL

FRA2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Ncoa5 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4555303 1.0 µg DNA

Ncoa5 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PA2G4 antibody
FNab06092 100 µg

PA2G4 antibody

Sign In for Pricing
View Details
Tpsg1 3'UTR Lenti-reporter-Luc Vector
47404086 1.0 µg

Tpsg1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Thyroid Stimulating Hormone (TSH, Thyrotropin beta, TSH-beta, TSH-B, TSHB) (PE) discontinued
T5400-43F-PE 100 µL

Thyroid Stimulating Hormone (TSH, Thyrotropin beta, TSH-beta, TSH-B, TSHB) (PE) discontinued

Sign In for Pricing
View Details