Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 5 (TVA5), Biotinylated

This Recombinant Human T cell receptor alpha variable 5 (TVA5), Biotinylated spans the amino acid sequence from region 23-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 5 TRAV5

UniProt

A0A0B4J249

Expression Region

23-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor I (CFI) Mouse Monoclonal Antibody [Clone ID: OTI6G7]
CF806009 100 µg

Factor I (CFI) Mouse Monoclonal Antibody [Clone ID: OTI6G7]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS502990 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Recombinant SUMO Conjugating Enzyme UBC9 Monoclonal Antibody
E-AB-81514-01 50 µL

Recombinant SUMO Conjugating Enzyme UBC9 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SUMO Conjugating Enzyme UBC9 Monoclonal Antibody
E-AB-81514-02 100 µL

Recombinant SUMO Conjugating Enzyme UBC9 Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS501597 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/795), CF640R conjugate, 0.1mg/mL
BNC400795-500 1x 500 µL

CD56 / NCAM (NCAM1/795), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details