Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 5 (TVA5), Biotinylated

This Recombinant Human T cell receptor alpha variable 5 (TVA5), Biotinylated spans the amino acid sequence from region 23-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 5 TRAV5

UniProt

A0A0B4J249

Expression Region

23-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (KRT10/844), CF488A conjugate, 0.1mg/mL
BNC880844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF690 / ZSCAN29 (ZSCAN29/2610), 1mg/mL
BNUM2610-50 1x 50 µL

ZNF690 / ZSCAN29 (ZSCAN29/2610), 1mg/mL

Sign In for Pricing
View Details
DUSP7 (N-term) Rabbit Polyclonal Antibody
AP15266PU-N 400 µL

DUSP7 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCAF Recombinant Rabbit Monoclonal Antibody [JU88-63]
ET7106-79 100 µL

PCAF Recombinant Rabbit Monoclonal Antibody [JU88-63]

Sign In for Pricing
View Details
VSV-G-Tag Monoclonal Antibody
E-AB-20011-01 30 µL

VSV-G-Tag Monoclonal Antibody

Sign In for Pricing
View Details
VSV-G-Tag Monoclonal Antibody
E-AB-20011-02 60 µL

VSV-G-Tag Monoclonal Antibody

Sign In for Pricing
View Details