Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 5 (TVA5), Biotinylated

This Recombinant Human T cell receptor alpha variable 5 (TVA5), Biotinylated spans the amino acid sequence from region 23-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 5 TRAV5

UniProt

A0A0B4J249

Expression Region

23-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL3, ID (KLHL3, KIAA1129, Kelch-like protein 3) (MaxLight 650) discontinued
037556-ML650 100 µL

KLHL3, ID (KLHL3, KIAA1129, Kelch-like protein 3) (MaxLight 650) discontinued

Sign In for Pricing
View Details
EED Recombinant Rabbit mAb
BS49353-01 50 µL

EED Recombinant Rabbit mAb

Sign In for Pricing
View Details
EED Recombinant Rabbit mAb
BS49353-02 100 µL

EED Recombinant Rabbit mAb

Sign In for Pricing
View Details
PTCH2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1748708 1.0 µg DNA

PTCH2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal SCAMP2 Antibody
NBP2-93520-0.02mL 0.02 mL

Rabbit Polyclonal SCAMP2 Antibody

Sign In for Pricing
View Details
EARS2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
18863151 3x 1.0 µg DNA

EARS2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details