Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-6 (TVA86), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-6 (TVA86), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-6 TRAV8-6

UniProt

A0A0B4J262

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVESINGFEAEFNKSQTSFHLRKPSVHISDTAEYFCAVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LANCL1 (NM_001136575) Human Recombinant Protein
TP326718 20 µg

LANCL1 (NM_001136575) Human Recombinant Protein

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), Biotin conjugate, 0.1mg/mL
BNCB1976-100 1x 100 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Hydroxy-Alpha-(1-hydroxycyclohexyl)benzeneacetonitrile
TRC-H942855-1G 1 g

4-Hydroxy-Alpha-(1-hydroxycyclohexyl)benzeneacetonitrile

Sign In for Pricing
View Details
ERK1 (MAPK3) Mouse Monoclonal Antibody [Clone ID: AT1A2]
AM09379PU-S 50 µL

ERK1 (MAPK3) Mouse Monoclonal Antibody [Clone ID: AT1A2]

Sign In for Pricing
View Details
Cytochrome p450 2J2 (CYP2J2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A3]
TA503483BM 100 µL

Cytochrome p450 2J2 (CYP2J2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A3]

Sign In for Pricing
View Details
APC Anti-Mouse CD20 Antibody[SA271G2]
E-AB-F1403E-01 50 Tests

APC Anti-Mouse CD20 Antibody[SA271G2]

Sign In for Pricing
View Details