Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-6 (TVA86), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-6 (TVA86), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-6 TRAV8-6

UniProt

A0A0B4J262

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVESINGFEAEFNKSQTSFHLRKPSVHISDTAEYFCAVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JKAMP (NM_001098625) Human 3' UTR Clone
SC213752 10 µg

JKAMP (NM_001098625) Human 3' UTR Clone

Sign In for Pricing
View Details
Nomegestrol Acetate-d6
CS-T-99457 1 Each

Nomegestrol Acetate-d6

Sign In for Pricing
View Details
NCI-H2052 GFP Reporter Cell Line
ABC-RC107H 1 Vial

NCI-H2052 GFP Reporter Cell Line

Sign In for Pricing
View Details
PNPLA2 Protein Vector (Mouse) (pPM-C-HA)
PV217580 500 ng

PNPLA2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ELISA Kit FOR Calcium-regulated heat stable protein 1
E14070m 96 Tests

ELISA Kit FOR Calcium-regulated heat stable protein 1

Sign In for Pricing
View Details
Recombinant Escherichia coli Autoinducer 2 import system permease protein lsrD (lsrD), partial
MBS1243526-01 1 mg (E-Coli)

Recombinant Escherichia coli Autoinducer 2 import system permease protein lsrD (lsrD), partial

Sign In for Pricing
View Details