Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 39 (TVA39), Biotinylated

This Recombinant Human T cell receptor alpha variable 39 (TVA39), Biotinylated spans the amino acid sequence from region 19-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 39 TRAV39

UniProt

A0A0B4J263

Expression Region

19-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ELKVEQNPLFLSMQEGKNYTIYCNYSTTSDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSTLHITAAVHDLSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF329 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E5]
TA809557BM 100 µL

ZNF329 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E5]

Sign In for Pricing
View Details
Diuron-d6
TRC-D494417-50MG 50 mg

Diuron-d6

Sign In for Pricing
View Details
DiYO™-1 [equivalent to YOYO®-1]
17579-AAT 1 mg

DiYO™-1 [equivalent to YOYO®-1]

Sign In for Pricing
View Details
Propylphosphonic Acid
TRC-P835080-5G 5 g

Propylphosphonic Acid

Sign In for Pricing
View Details
1-(2,3-Epoxypropyl)-2-nitroimidazole
TRC-B592583-250MG 250 mg

1-(2,3-Epoxypropyl)-2-nitroimidazole

Sign In for Pricing
View Details
FITC Conjugated Arachis hypogaea Lectin (Peanut) -PNA-
F-2301-2 2 mg

FITC Conjugated Arachis hypogaea Lectin (Peanut) -PNA-

Sign In for Pricing
View Details