Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 39 (TVA39), Biotinylated

This Recombinant Human T cell receptor alpha variable 39 (TVA39), Biotinylated spans the amino acid sequence from region 19-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 39 TRAV39

UniProt

A0A0B4J263

Expression Region

19-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ELKVEQNPLFLSMQEGKNYTIYCNYSTTSDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSTLHITAAVHDLSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Macaca fascicularis Acetoacetyl-CoA synthetase (AACS), partial
MBS1453277 Inquire

Recombinant Macaca fascicularis Acetoacetyl-CoA synthetase (AACS), partial

Sign In for Pricing
View Details
AEW-541 free base
204210 10.0mg

AEW-541 free base

Sign In for Pricing
View Details
Monkey 14, 15-dihydroxy-eicosatrienoic acid ELISA Kit
GTR10365109 96 Well

Monkey 14, 15-dihydroxy-eicosatrienoic acid ELISA Kit

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0133 protein SP70585_1174 (SP70585_1174)
MBS1030544-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae UPF0133 protein SP70585_1174 (SP70585_1174)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0133 protein SP70585_1174 (SP70585_1174)
MBS1030544-02 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae UPF0133 protein SP70585_1174 (SP70585_1174)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae UPF0133 protein SP70585_1174 (SP70585_1174)
MBS1030544-03 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae UPF0133 protein SP70585_1174 (SP70585_1174)

Sign In for Pricing
View Details