Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 38-1 (TV381), Biotinylated

This Recombinant Human T cell receptor alpha variable 38-1 (TV381), Biotinylated spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 38-1 TRAV38-1

UniProt

A0A0B4J264

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVTQSQPEMSVQEAETVTLSCTYDTSENNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNA13 (IFNA1) (NM_024013) Human Over-expression Lysate
LC402974 20 µg

IFNA13 (IFNA1) (NM_024013) Human Over-expression Lysate

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF640R conjugate, 0.1mg/mL
BNC400245-500 1x 500 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), 0.2mg/mL
BNUB0521-500 1x 500 µL

AFP (Alpha Fetoprotein) (MBS-12), 0.2mg/mL

Sign In for Pricing
View Details
PATE2 (NM_212555) Human Over-expression Lysate
LC403898 20 µg

PATE2 (NM_212555) Human Over-expression Lysate

Sign In for Pricing
View Details
ADCK3 (COQ8A) (NM_020247) Human Over-expression Lysate
LC402769 20 µg

ADCK3 (COQ8A) (NM_020247) Human Over-expression Lysate

Sign In for Pricing
View Details
Cumene
TRC-C834590-1G 1 g

Cumene

Sign In for Pricing
View Details