Recombinant Human T cell receptor alpha variable 38-1 (TV381), Biotinylated
This Recombinant Human T cell receptor alpha variable 38-1 (TV381), Biotinylated spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
T cell receptor alpha variable 38-1 TRAV38-1
UniProt
A0A0B4J264
Expression Region
22-116
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
QTVTQSQPEMSVQEAETVTLSCTYDTSENNYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAFMK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
L-3101-1 1 mg
Pure Wisteria floribunda Lectin (Japanese Wisteria) -WFA-
Sign In for Pricing
View Details 
