Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 4 (TVA4), Biotinylated

This Recombinant Human T cell receptor alpha variable 4 (TVA4), Biotinylated spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 4 TRAV4

UniProt

A0A0B4J268

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAN32 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV753176 1.0 µg DNA

TRNAN32 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Annexin V, CF®740 Conjugate
#29126 1x 500 µL

Annexin V, CF®740 Conjugate

Sign In for Pricing
View Details
Rat HMGB-1 (High Mobility Group Protein B1) ELISA Kit
EK250672 96 Well

Rat HMGB-1 (High Mobility Group Protein B1) ELISA Kit

Sign In for Pricing
View Details
Zeta- (6-Aminohexyl) -dG6P-AZDye568
NU-284-AZ568-S 20 µL

Zeta- (6-Aminohexyl) -dG6P-AZDye568

Sign In for Pricing
View Details
Rat Bpnt1 ELISA Kit
ELI-10949r 96 Tests

Rat Bpnt1 ELISA Kit

Sign In for Pricing
View Details
H CCR1 (CD191) Expression Lentivirus
LVP719 1x 10^7 IFU/mL - 200 μL

H CCR1 (CD191) Expression Lentivirus

Sign In for Pricing
View Details