Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 34 (TVA34), Biotinylated

This Recombinant Human T cell receptor alpha variable 34 (TVA34), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 34 TRAV34

UniProt

A0A0B4J273

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPA 202248-d3
TRC-R700917-5MG 5 mg

RPA 202248-d3

Sign In for Pricing
View Details
Aco2 Mouse Gene Knockout Kit (CRISPR)
KN500726 1 Kit

Aco2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Low Temperature Circulator BCLT-401
BCLT-401 1 Unit

Low Temperature Circulator BCLT-401

Sign In for Pricing
View Details
Eotaxin 2 (CCL24) Human Gene Knockout Kit (CRISPR)
KN220724RB 1 Kit

Eotaxin 2 (CCL24) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FCRLB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G1]
TA809247AM 100 µL

FCRLB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G1]

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF647 conjugate, 0.1mg/mL
BNC472346-500 1x 500 µL

AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details