Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 20 (TVA20), Biotinylated

This Recombinant Human T cell receptor alpha variable 20 (TVA20), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 20 TRAV20

UniProt

A0A0B4J274

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RP4 Plasmid
PVT46791 2 µg

RP4 Plasmid

Sign In for Pricing
View Details
PSD95 Antibody (Biotin)
orb147024 100 µg

PSD95 Antibody (Biotin)

Sign In for Pricing
View Details
HSPE1P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV728944 1.0 µg DNA

HSPE1P1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
LHFPL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1212706 1.0 µg DNA

LHFPL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ADAM20 Rabbit Polyclonal Antibody
TA420421 100 µg

ADAM20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ubqln5 shRNA (UAS) - Lentiviral mouse Ubqln5 shRNA (UAS, iRFP) plasmid
GTR15228736 1 Vial

Lentiviral mouse Ubqln5 shRNA (UAS) - Lentiviral mouse Ubqln5 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details