Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 20 (TVA20), Biotinylated

This Recombinant Human T cell receptor alpha variable 20 (TVA20), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 20 TRAV20

UniProt

A0A0B4J274

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gnl3l 3'UTR GFP Stable Cell Line
TU158880 1.0 mL

Gnl3l 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-FAP (Rabbit, Monoclonal)
A107678 100 µL

Anti-FAP (Rabbit, Monoclonal)

Sign In for Pricing
View Details
LANCL3 3'UTR Luciferase Stable Cell Line
TU012262 1.0 mL

LANCL3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Cylc2 shRNA (UAS) - Lentiviral mouse Cylc2 shRNA (UAS, iRFP) (100)
GTR15245859 1 Vial

Lentiviral mouse Cylc2 shRNA (UAS) - Lentiviral mouse Cylc2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Anti-Nefh Antibody Picoband®, iFluor647 Conjugate
A05307-iFluor647 100 µg

Anti-Nefh Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 10 (SIGLEC10)
MBS2006249-01 0.1 mL

Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 10 (SIGLEC10)

Sign In for Pricing
View Details