Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 20 (TVA20), Biotinylated

This Recombinant Human T cell receptor alpha variable 20 (TVA20), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 20 TRAV20

UniProt

A0A0B4J274

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Proinsulin (PI) ELISA Kit
orb2813424-01 48 Tests

Human Proinsulin (PI) ELISA Kit

Sign In for Pricing
View Details
Human Proinsulin (PI) ELISA Kit
orb2813424-02 96 Tests

Human Proinsulin (PI) ELISA Kit

Sign In for Pricing
View Details
Human Proinsulin (PI) ELISA Kit
orb2813424-03 5 x 96 T

Human Proinsulin (PI) ELISA Kit

Sign In for Pricing
View Details
GFP hsa-miR-6752-5p AAV miRNA Vector
Amh1237800 500 ng

GFP hsa-miR-6752-5p AAV miRNA Vector

Sign In for Pricing
View Details
Nori® Salmon TNFRI ELISA Kit
GR202030 96 Well

Nori® Salmon TNFRI ELISA Kit

Sign In for Pricing
View Details
ACSL3 ORF Vector (Human) (pORF)
ORF015237 1.0 µg DNA

ACSL3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details