Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 20 (TVA20), Biotinylated

This Recombinant Human T cell receptor alpha variable 20 (TVA20), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 20 TRAV20

UniProt

A0A0B4J274

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Swine 8-Hydroxydeoxyguanosine (8-OHdG) ELISA Kit-Competitive
EK2F181 96 Tests

Swine 8-Hydroxydeoxyguanosine (8-OHdG) ELISA Kit-Competitive

Sign In for Pricing
View Details
Anti-MEK-7 (phospho-S271) MAP2K7 Antibody
A02713S271 100 µL

Anti-MEK-7 (phospho-S271) MAP2K7 Antibody

Sign In for Pricing
View Details
Lysinenorleucine
MBS5782634 Inquire

Lysinenorleucine

Sign In for Pricing
View Details
ALDH7A1P1 Protein Vector (Human) (pPB-His-GST)
PV321203 500 ng

ALDH7A1P1 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Mouse Monoclonal TRAIL R1/TNFRSF10A Antibody (DR-4-02) [Alexa Fluor 750]
NBP2-31343AF750 0.1 mL

Mouse Monoclonal TRAIL R1/TNFRSF10A Antibody (DR-4-02) [Alexa Fluor 750]

Sign In for Pricing
View Details
Tridecanoic acid
HY-Y1718-01 1 g

Tridecanoic acid

Sign In for Pricing
View Details