Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 17 (TVA17), Biotinylated

This Recombinant Human T cell receptor alpha variable 17 (TVA17), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 17 TRAV17

UniProt

A0A0B4J275

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF1 siRNA (Human)
CRH3506-01 15 nmol

PHF1 siRNA (Human)

Sign In for Pricing
View Details
PHF1 siRNA (Human)
CRH3506-02 30 nmol

PHF1 siRNA (Human)

Sign In for Pricing
View Details
Phospho-Cyclin B1 (Ser126) Antibody (YA6217, Rabbit)
HY-P86525 1 Each

Phospho-Cyclin B1 (Ser126) Antibody (YA6217, Rabbit)

Sign In for Pricing
View Details
Rhox4d Lentiviral Activation Particles (m)
sc-437061-LAC 200 µL

Rhox4d Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Human OLFML3 Protein, His Tag
orb1496260-01 1 mg

Human OLFML3 Protein, His Tag

Sign In for Pricing
View Details
Human OLFML3 Protein, His Tag
orb1496260-02 100 µg

Human OLFML3 Protein, His Tag

Sign In for Pricing
View Details