Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 17 (TVA17), Biotinylated

This Recombinant Human T cell receptor alpha variable 17 (TVA17), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 17 TRAV17

UniProt

A0A0B4J275

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5L Protein Lysate
OCOA01632-20UG 20 µg

CD5L Protein Lysate

Sign In for Pricing
View Details
Ethyl 1- (tert-butyl) -4,5-dioxopyrrolidine-3-carboxylate
OR25022 1 Each

Ethyl 1- (tert-butyl) -4,5-dioxopyrrolidine-3-carboxylate

Sign In for Pricing
View Details
Ptgs2 Recombinant Antibody
RAC07262-01 50 µL

Ptgs2 Recombinant Antibody

Sign In for Pricing
View Details
Ptgs2 Recombinant Antibody
RAC07262-02 100 µL

Ptgs2 Recombinant Antibody

Sign In for Pricing
View Details
DMRTB1 (Doublesex-and Mab-3-related Transcription Factor B1, DMRT-like Family B with Proline-Rich C-terminal, 1)
479471 100 µL

DMRTB1 (Doublesex-and Mab-3-related Transcription Factor B1, DMRT-like Family B with Proline-Rich C-terminal, 1)

Sign In for Pricing
View Details
ACTR3B polyclonal antibody
orb647098-01 50 μL

ACTR3B polyclonal antibody

Sign In for Pricing
View Details