Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 22 (TVA22), Biotinylated

This Recombinant Human T cell receptor alpha variable 22 (TVA22), Biotinylated spans the amino acid sequence from region 22-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 22 TRAV22

UniProt

A0A0B4J277

Expression Region

22-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf204 Protein Lysate (Human) with C-Ha Tag
14183031 100 µg

C1orf204 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
EMD antibody | AB01/4H6
MBS226337-01 0.1 mL

EMD antibody | AB01/4H6

Sign In for Pricing
View Details
EMD antibody | AB01/4H6
MBS226337-02 5x 0.1 mL

EMD antibody | AB01/4H6

Sign In for Pricing
View Details
DKK1 Antibody - C-terminal region
MBS3212022-01 0.1 mL

DKK1 Antibody - C-terminal region

Sign In for Pricing
View Details
DKK1 Antibody - C-terminal region
MBS3212022-02 5x 0.1 mL

DKK1 Antibody - C-terminal region

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody [Clone ID: CVS4]
SM497F 100 µg

CD4 Mouse Monoclonal Antibody [Clone ID: CVS4]

Sign In for Pricing
View Details