Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 21 (TVA21), Biotinylated

This Recombinant Human T cell receptor alpha variable 21 (TVA21), Biotinylated spans the amino acid sequence from region 20-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 21 TRAV21

UniProt

A0A0B4J279

Expression Region

20-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gel-BrightTM Laser Diode Gel Illuminator
#E90005 1 Each

Gel-BrightTM Laser Diode Gel Illuminator

Sign In for Pricing
View Details
AASS (C-term) Rabbit Polyclonal Antibody
AP50013PU-N 400 µL

AASS (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-(2'-Deoxy-5'-O-DMT-3'-O-nitrophenylsulphonyl-b-D-lyxofuranosyl)thymine
TRC-D210870-50MG 50 mg

1-(2'-Deoxy-5'-O-DMT-3'-O-nitrophenylsulphonyl-b-D-lyxofuranosyl)thymine

Sign In for Pricing
View Details
4-Amino-6-hydroxy-1,3-benzenedicarboxylic Acid
TRC-A634570-5MG 5 mg

4-Amino-6-hydroxy-1,3-benzenedicarboxylic Acid

Sign In for Pricing
View Details
Mix-n-StainTM Cyanine 555 Antibody Labeling Kit, 1x (5-20ug) labeling
#92412 1 Kit

Mix-n-StainTM Cyanine 555 Antibody Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details
Rasgef1a Mouse Gene Knockout Kit (CRISPR)
KN514498 1 Kit

Rasgef1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details