Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 21 (TVA21), Biotinylated

This Recombinant Human T cell receptor alpha variable 21 (TVA21), Biotinylated spans the amino acid sequence from region 20-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 21 TRAV21

UniProt

A0A0B4J279

Expression Region

20-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADD1 Antibody
OC-1853-01 50 μL

ADD1 Antibody

Sign In for Pricing
View Details
ADD1 Antibody
OC-1853-02 100 µL

ADD1 Antibody

Sign In for Pricing
View Details
ADD1 Antibody
OC-1853-03 1 mL

ADD1 Antibody

Sign In for Pricing
View Details
Human KLLN activation kit by CRISPRa
GA119187 1 Kit

Human KLLN activation kit by CRISPRa

Sign In for Pricing
View Details
S6K1 (RPS6KB1) (NM_003161) Human Over-expression Lysate
LY401097 100 µg

S6K1 (RPS6KB1) (NM_003161) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS702222 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details