Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 21 (TVA21), Biotinylated

This Recombinant Human T cell receptor alpha variable 21 (TVA21), Biotinylated spans the amino acid sequence from region 20-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 21 TRAV21

UniProt

A0A0B4J279

Expression Region

20-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human VWC2L activation kit by CRISPRa
GA118356 1 Kit

Human VWC2L activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS636948 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Uncoated Rat IgG2b (Immunoglobulin G2b) ELISA Kit
E-UNEL-R0072-01 5x 96 Tests

Uncoated Rat IgG2b (Immunoglobulin G2b) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat IgG2b (Immunoglobulin G2b) ELISA Kit
E-UNEL-R0072-02 15x 96 Tests

Uncoated Rat IgG2b (Immunoglobulin G2b) ELISA Kit

Sign In for Pricing
View Details
ACCN1 (ASIC2) Human qPCR Primer Pair (NM_183377)
HP232138 200 Reactions

ACCN1 (ASIC2) Human qPCR Primer Pair (NM_183377)

Sign In for Pricing
View Details
4-Bromo-1-propan-2-ylpyridin-2-one
TRC-B993595-50MG 50 mg

4-Bromo-1-propan-2-ylpyridin-2-one

Sign In for Pricing
View Details