Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-13 IGKV1D-13

UniProt

A0A0B4J2D9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vps18 Mouse Gene Knockout Kit (CRISPR)
KN519245 1 Kit

Vps18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2672), 1mg/mL
BNUM2672-50 1x 50 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2672), 1mg/mL

Sign In for Pricing
View Details
GRM1 Antibody
8G363-AAT 50 µg

GRM1 Antibody

Sign In for Pricing
View Details
Urinary Indican Test Kit
I1000N 20 Tests

Urinary Indican Test Kit

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/3249), CF740 conjugate, 0.1mg/mL
BNC743249-500 1x 500 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/3249), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Triuret
TRC-T891753-500MG 500 mg

Triuret

Sign In for Pricing
View Details