Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-13 IGKV1D-13

UniProt

A0A0B4J2D9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta Casein (CSN2) (NM_001891) Human Over-expression Lysate
LC419688 20 µg

beta Casein (CSN2) (NM_001891) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC25A20 Human Gene Knockout Kit (CRISPR)
KN400234 1 Kit

SLC25A20 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Conjugated Laburnum anagyroides Lectin (Gold Chain) -LAL-
F-8101-1 1 mg

FITC Conjugated Laburnum anagyroides Lectin (Gold Chain) -LAL-

Sign In for Pricing
View Details
SMURF 2 (SMURF2) Human Gene Knockout Kit (CRISPR)
KN210866BN 1 Kit

SMURF 2 (SMURF2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human NALP12 (NLRP12) activation kit by CRISPRa
GA114138 1 Kit

Human NALP12 (NLRP12) activation kit by CRISPRa

Sign In for Pricing
View Details
Stearoyl Ethanolamide
TRC-S686608-1G 1 g

Stearoyl Ethanolamide

Sign In for Pricing
View Details