Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-4 (TVBL4), Biotinylated

This Recombinant Human T cell receptor beta variable 12-4 (TVBL4), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-4 TRBV12-4

UniProt

A0A0B4J2E0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf72 Rabbit Polyclonal Antibody (BF750)
orb2483401 100 µL

C12orf72 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Vmn1r123 3'UTR Luciferase Stable Cell Line
TU121800 1.0 mL

Vmn1r123 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PTGER2 AAV siRNA Pooled Vector
38081161 1.0 µg

PTGER2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Arginase II (Arg2) Recombinant, Rat
153606-01 10 µg

Arginase II (Arg2) Recombinant, Rat

Sign In for Pricing
View Details
Arginase II (Arg2) Recombinant, Rat
153606-02 50 µg

Arginase II (Arg2) Recombinant, Rat

Sign In for Pricing
View Details
Arginase II (Arg2) Recombinant, Rat
153606-03 200 µg

Arginase II (Arg2) Recombinant, Rat

Sign In for Pricing
View Details