Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-4 (TVBL4), Biotinylated

This Recombinant Human T cell receptor beta variable 12-4 (TVBL4), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-4 TRBV12-4

UniProt

A0A0B4J2E0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal LZIC Antibody (OTI3A7) [Janelia Fluor 646]
NBP2-72559JF646 0.1 mL

Mouse Monoclonal LZIC Antibody (OTI3A7) [Janelia Fluor 646]

Sign In for Pricing
View Details
Smarcb1-set siRNA/shRNA/RNAi Lentivector (Rat)
44413096 4x 500 ng

Smarcb1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Cofilin 1 CRISPR/Cas9 KO Plasmid (m)
sc-419636 20 µg

Cofilin 1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
PHF21B (15U13) Mouse Monoclonal antibody
E28PE5094 100 µL

PHF21B (15U13) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Human Toll-like receptor 2 ELISA Kit
MBS2887396-01 48 Well

Human Toll-like receptor 2 ELISA Kit

Sign In for Pricing
View Details
Human Toll-like receptor 2 ELISA Kit
MBS2887396-02 96 Well

Human Toll-like receptor 2 ELISA Kit

Sign In for Pricing
View Details