Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69D IGHV1-69D

UniProt

A0A0B4J2H0

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cynomolgus CD7 (C-6His)
C07K-10ug 10 µg

Recombinant Cynomolgus CD7 (C-6His)

Sign In for Pricing
View Details
Monkey IL1B Matched Antibody Pair Set [ABP-S-021153]
ABP-S-021153 5 Plates

Monkey IL1B Matched Antibody Pair Set [ABP-S-021153]

Sign In for Pricing
View Details
Signal Recognition Particle Receptor B (SRPRB), Recombinant, Mouse, His-Tag
049459-01 10 µg

Signal Recognition Particle Receptor B (SRPRB), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Signal Recognition Particle Receptor B (SRPRB), Recombinant, Mouse, His-Tag
049459-02 50 µg

Signal Recognition Particle Receptor B (SRPRB), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Signal Recognition Particle Receptor B (SRPRB), Recombinant, Mouse, His-Tag
049459-03 100 µg

Signal Recognition Particle Receptor B (SRPRB), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Signal Recognition Particle Receptor B (SRPRB), Recombinant, Mouse, His-Tag
049459-04 200 µg

Signal Recognition Particle Receptor B (SRPRB), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details