Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69D IGHV1-69D

UniProt

A0A0B4J2H0

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hu CD340 Purified, clone 24D2 (Monoclonal) Antibody
orb1882453 0.1 mg

Mouse Hu CD340 Purified, clone 24D2 (Monoclonal) Antibody

Sign In for Pricing
View Details
Glyctk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
21671114 3x 1.0 µg

Glyctk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Lzts2 (NM_001130526) Mouse Recombinant Protein
E45M43025M5 20 µg

Lzts2 (NM_001130526) Mouse Recombinant Protein

Sign In for Pricing
View Details
RPS7P14 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV782644 1.0 µg DNA

RPS7P14 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Mouse N-Acetyl Beta-D-Glucosaminidase (NAGase) ELISA Kit
orb1664606-01 48 Tests

Mouse N-Acetyl Beta-D-Glucosaminidase (NAGase) ELISA Kit

Sign In for Pricing
View Details
Mouse N-Acetyl Beta-D-Glucosaminidase (NAGase) ELISA Kit
orb1664606-02 96 Tests

Mouse N-Acetyl Beta-D-Glucosaminidase (NAGase) ELISA Kit

Sign In for Pricing
View Details