Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69D IGHV1-69D

UniProt

A0A0B4J2H0

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPA, Human Recombinant (Sf9)
P1325-5 5 µg

TPA, Human Recombinant (Sf9)

Sign In for Pricing
View Details
Nodularin-R (NRC Certified Calibration Solution) Concentration: 12.4 μmol/L of NODR in aqueous Methanol (1:1 v/v)
460839 500 µL

Nodularin-R (NRC Certified Calibration Solution) Concentration: 12.4 μmol/L of NODR in aqueous Methanol (1:1 v/v)

Sign In for Pricing
View Details
2- (1H-1,2,4-triazol-1-yl) benzoic acid
sc-282444 100 mg

2- (1H-1,2,4-triazol-1-yl) benzoic acid

Sign In for Pricing
View Details
Mouse Monoclonal Claudin-5 Antibody (OTI1G4) [Janelia Fluor 646]
NBP2-71329JF646 0.1 mL

Mouse Monoclonal Claudin-5 Antibody (OTI1G4) [Janelia Fluor 646]

Sign In for Pricing
View Details
FAM60A Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV638777 1.0 µg DNA

FAM60A Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Human GZMK Protein, N-His
YHE72501 100 μg

Recombinant Human GZMK Protein, N-His

Sign In for Pricing
View Details