Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6-21 (KV621), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 6-21 (KV621), Biotinylated spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6-21 IGKV6-21

UniProt

A0A0C4DH24

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep BTB/POZ domain containing protein 3 (BTBD3) ELISA Kit
GTR10341718 96 Well

Sheep BTB/POZ domain containing protein 3 (BTBD3) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal DPH2 Antibody (5B10)
H00001802-M02 0.1 mg

Mouse Monoclonal DPH2 Antibody (5B10)

Sign In for Pricing
View Details
Ifih1 3'UTR GFP Stable Cell Line
TU256108 1.0 mL

Ifih1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)
MBS1478393-01 0.02 mg (E-Coli)

Recombinant Rhodoferax ferrireducens 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)
MBS1478393-02 0.02 mg (Yeast)

Recombinant Rhodoferax ferrireducens 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)

Sign In for Pricing
View Details
Recombinant Rhodoferax ferrireducens 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)
MBS1478393-03 0.1 mg (E-Coli)

Recombinant Rhodoferax ferrireducens 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)

Sign In for Pricing
View Details