Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20), Biotinylated spans the amino acid sequence from region 21-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-20 IGKV3D-20

UniProt

A0A0C4DH25

Expression Region

21-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCGASQSVSSSYLAWYQQKPGLAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRLS1 AAV Vector (Mouse) (CMV)
16847104 1 µg

CRLS1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
PCDH8 Polyclonal Antibody
MBS9233955-01 0.1 mL

PCDH8 Polyclonal Antibody

Sign In for Pricing
View Details
PCDH8 Polyclonal Antibody
MBS9233955-02 5x 0.1 mL

PCDH8 Polyclonal Antibody

Sign In for Pricing
View Details
TNS4 (Tensin-4, C-terminal Tensin-like Protein, CTEN, PP14434) (MaxLight 490)
134588-ML490 100 µL

TNS4 (Tensin-4, C-terminal Tensin-like Protein, CTEN, PP14434) (MaxLight 490)

Sign In for Pricing
View Details
DTYMK Conjugated Antibody
orb1619601 100 µL

DTYMK Conjugated Antibody

Sign In for Pricing
View Details
Hsa-miR-5003-5p miRNA Antagomir
orb1914571-01 10 nmol

Hsa-miR-5003-5p miRNA Antagomir

Sign In for Pricing
View Details