Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 6D-41 IGKV6D-41

UniProt

A0A0C4DH26

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPAFLSVTPGEKVTITCQASEGIGNYLYWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFTISSLEAEDAATYYCQQGNKHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza A Hemagglutinin (H3N2)
138671-01 50 µL

Influenza A Hemagglutinin (H3N2)

Sign In for Pricing
View Details
Influenza A Hemagglutinin (H3N2)
138671-02 100 µL

Influenza A Hemagglutinin (H3N2)

Sign In for Pricing
View Details
Zfp668 Protein Vector (Mouse) (pPB-N-His)
PV249979 500 ng

Zfp668 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
W/W047/NL438/ALU-450X150-1 Marine & IMO Signs (No Adhesive)
300834 1 Pack (1 Panel (s) x 1 Pack)

W/W047/NL438/ALU-450X150-1 Marine & IMO Signs (No Adhesive)

Sign In for Pricing
View Details
Mouse Monoclonal SCL/Tal1 Antibody (BTL73) [DyLight 405]
NBP3-08616V 100 µL

Mouse Monoclonal SCL/Tal1 Antibody (BTL73) [DyLight 405]

Sign In for Pricing
View Details
Cd207 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4909206 1.0 µg DNA

Cd207 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details