Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 6D-41 IGKV6D-41

UniProt

A0A0C4DH26

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPAFLSVTPGEKVTITCQASEGIGNYLYWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFTISSLEAEDAATYYCQQGNKHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASIP siRNA (Human)
CRH0313-01 15 nmol

ASIP siRNA (Human)

Sign In for Pricing
View Details
ASIP siRNA (Human)
CRH0313-02 30 nmol

ASIP siRNA (Human)

Sign In for Pricing
View Details
Recombinant Mycobacterium Gilvum Mflv_4776 Protein (aa 1-209)
VAng-Yyj3939-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Gilvum Mflv_4776 Protein (aa 1-209)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces Pombe SPAC13G6.09 Protein (aa 1-274)
VAng-Yyj6386-1mgEcoli 1 mg (E. coli)

Recombinant Schizosaccharomyces Pombe SPAC13G6.09 Protein (aa 1-274)

Sign In for Pricing
View Details
Rabbit Polyclonal NLRP14 Antibody [PerCP]
NBP2-81748PCP 0.1 mL

Rabbit Polyclonal NLRP14 Antibody [PerCP]

Sign In for Pricing
View Details
Anti-STAT6 Antibody Picoband® Fluoro550 Conjugated
PB9405-Fluoro550 100 µg/Vial

Anti-STAT6 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details